General Information

  • ID:  hor000179
  • Uniprot ID:  P55321
  • Protein name:  Molt-inhibiting hormone
  • Gene name:  NA
  • Organism:  Callinectes sapidus (Blue crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Callinectes (genus), Portuninae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RVINDDCPNLIGNRDLYKKVEWICDDCANIYRSTGMASLCRKDCFFNEDFLWCVRATERSEDLAQLKQWVTILGAGRI
  • Length:  78(36-113)
  • Propeptide:  MMSLAHSKFSCQRTRLLAVVLLAALWSSSLQQAAARVINDDCPNLIGNRDLYKKVEWICDDCANIYRSTGMASLCRKDCFFNEDFLWCVRATERSEDLAQLKQWVTILGAGRI
  • Signal peptide:  MMSLAHSKFSCQRTRLLAVVLLAALWSSSLQQAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-44; 24-40; 27-53
  • Structure ID:  AF-P08949-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P08949-F1.pdbhor000179_AF2.pdbhor000179_ESM.pdb

Physical Information

Mass: 1045107 Formula: C396H621N113O118S7
Absent amino acids: H Common amino acids: DLR
pI: 5.03 Basic residues: 11
Polar residues: 23 Hydrophobic residues: 28
Hydrophobicity: -28.08 Boman Index: -16722
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 86.28
Instability Index: 3806.28 Extinction Coefficient cystines: 19855
Absorbance 280nm: 257.86

Literature

  • PubMed ID:  7537497
  • Title:  Molecular Cloning of a cDNA Encoding Putative Molt-Inhibiting Hormone From the Blue Crab, Callinectes Sapidus